| Desktop | 69/100 | ❗ |
| Mobile | 67/100 | ❗ |
| Field | Data | Result |
|---|---|---|
| Page Size | 2 KB | ✔ |
| Compression | NO | ✘ |
| Text/Html Ratio | 581 / 1954 (bytes) = 29.73% | ✔ |
| Load Time | 1.33 second | ✘ |
| Mobile Ready | 0/100 | ✘ |
| In-Page Links | 5 | ✔ |
| Doc Type | HTML 5 | ✔ |
| Encoding | UTF-8 | ✔ |
| Declared Language | English | ✔ |
| Preferred Domain | Yes | ✔ |
| Robots.txt | Yes | ✔ |
| Url Rewrite | No | ✔ |
| Underscores in url | No | ✔ | Images Without ALT | 0 / 0 | ✔ |
| Embedded Objects (Desktop) | No | ✔ |
| Embedded Objects (Mobile) | No | ✔ |
| Iframe | No | ✔ |
| Custom 404 page | Yes | ✔ |
| Email Privacy | No | ✘ |
| Gsafe browsing | Yes | ✔ |
| Analytics | No | ✘ |
| W3C Validity | No | ✘ |
| Keywords | Freq | Title | Desc | <H> |
|---|---|---|---|---|
| academy | 3 | ✔ | ✔ | ✘ |
| leadership | 2 | ✔ | ✔ | ✘ |
| winfrey | 2 | ✔ | ✔ | ✘ |
| home | 1 | ✘ | ✘ | ✘ |
| please | 1 | ✘ | ✘ | ✘ |
| find | 1 | ✘ | ✘ | ✘ |
| contribute | 1 | ✘ | ✘ | ✘ |
| orfund | 1 | ✘ | ✘ | ✘ |
| bursary | 1 | ✘ | ✘ | ✘ |
| university | 1 | ✘ | ✘ | ✘ |
| theoprah | 1 | ✘ | ✘ | ✘ |
| contact | 1 | ✘ | ✘ | ✘ |
| individualsor | 1 | ✘ | ✘ | ✘ |
| oprah | 1 | ✔ | ✔ | ✘ |
| girls | 1 | ✔ | ✔ | ✘ |
|
With 1.33 seconds in page load, 2 KB of page size and all other reports below, the oprahwinfreyleadershipacademy.org has a SEO score of 63 out of 100 |
| Title | Oprah Winfrey Leadership Academy For Girls |
| Description | Oprah Winfrey Leadership Academy For Girls |
| Keyword |
| Age | 17 Years, 194 Days |
| Created | 7th-Jun-2006 |
| Updated | 11th-May-2023 |
| Expiry | 7th-Jun-2024 |
| Host | Type | Ttl | Other |
|---|---|---|---|
| oprahwinfreyleadershipacademy.org | A | 3587 | ip:3.33.139.32 |
| oprahwinfreyleadershipacademy.org | NS | 3587 | target:ns6.markmonitor.com |
| oprahwinfreyleadershipacademy.org | NS | 3587 | target:ns5.markmonitor.com |
| oprahwinfreyleadershipacademy.org | NS | 3587 | target:ns7.markmonitor.com |
| oprahwinfreyleadershipacademy.org | NS | 3587 | target:ns1.markmonitor.com |
| oprahwinfreyleadershipacademy.org | NS | 3587 | target:ns3.markmonitor.com |
| oprahwinfreyleadershipacademy.org | NS | 3587 | target:ns2.markmonitor.com |
| oprahwinfreyleadershipacademy.org | NS | 3587 | target:ns4.markmonitor.com |
| oprahwinfreyleadershipacademy.org | SOA | 86400 | mname:ns1.markmonitor.comrname:hostmaster.markmonitor.comserial:2014080103refresh:86400retry:3600expire:2592000minimum-ttl:172800 |
| oprahwinfreyleadershipacademy.org | MX | 86400 | pri:1target:bh.markmonitor.com |
|
HTTP/1.1 301 Moved Permanently Date: Mon, 18 Dec 2023 15:15:57 GMT Content-Type: text/plain; charset=utf-8 Content-Length: 56 Connection: keep-alive cache-control: no-cache, no-store, must-revalidate Pragma: no-cache Expires: -1 X-XSS-Protection: 1; mode=block X-Content-Type-Options: nosniff X-Frame-Options: DENY Content-Security-Policy: script-src 'self' Location: http://www.owla.co.za/ Vary: Accept HTTP/1.1 301 Moved Permanently Server: nginx Date: Mon, 18 Dec 2023 15:15:57 GMT Content-Type: text/html Content-Length: 162 Connection: keep-alive Location: https://www.owla.co.za/ HTTP/2 200 server: nginx date: Mon, 18 Dec 2023 15:15:58 GMT content-type: text/html content-length: 1954 last-modified: Wed, 18 Oct 2023 10:52:04 GMT etag: "652fb8d4-7a2" x-powered-by: PleskLin accept-ranges: bytes |
|
Domain Name: oprahwinfreyleadershipacademy.org Registry Domain ID: 5ad3cbcdbfa04941837dc990241a448a-LROR Registrar WHOIS Server: http://whois.markmonitor.com Registrar URL: http://www.markmonitor.com Updated Date: 2023-05-11T09:57:06Z Creation Date: 2006-06-07T15:05:49Z Registry Expiry Date: 2024-06-07T15:05:49Z Registrar: MarkMonitor Inc. Registrar IANA ID: 292 Registrar Abuse Contact Email: abusecomplaints@markmonitor.com Registrar Abuse Contact Phone: +1.2083895740 Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited Registry Registrant ID: REDACTED FOR PRIVACY Registrant Name: REDACTED FOR PRIVACY Registrant Organization: The Oprah Winfrey Leadership Academy Foundation Registrant Street: REDACTED FOR PRIVACY Registrant City: REDACTED FOR PRIVACY Registrant State/Province: CA Registrant Postal Code: REDACTED FOR PRIVACY Registrant Country: US Registrant Phone: REDACTED FOR PRIVACY Registrant Phone Ext: REDACTED FOR PRIVACY Registrant Fax: REDACTED FOR PRIVACY Registrant Fax Ext: REDACTED FOR PRIVACY Registrant Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name. Registry Admin ID: REDACTED FOR PRIVACY Admin Name: REDACTED FOR PRIVACY Admin Organization: REDACTED FOR PRIVACY Admin Street: REDACTED FOR PRIVACY Admin City: REDACTED FOR PRIVACY Admin State/Province: REDACTED FOR PRIVACY Admin Postal Code: REDACTED FOR PRIVACY Admin Country: REDACTED FOR PRIVACY Admin Phone: REDACTED FOR PRIVACY Admin Phone Ext: REDACTED FOR PRIVACY Admin Fax: REDACTED FOR PRIVACY Admin Fax Ext: REDACTED FOR PRIVACY Admin Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name. Registry Tech ID: REDACTED FOR PRIVACY Tech Name: REDACTED FOR PRIVACY Tech Organization: REDACTED FOR PRIVACY Tech Street: REDACTED FOR PRIVACY Tech City: REDACTED FOR PRIVACY Tech State/Province: REDACTED FOR PRIVACY Tech Postal Code: REDACTED FOR PRIVACY Tech Country: REDACTED FOR PRIVACY Tech Phone: REDACTED FOR PRIVACY Tech Phone Ext: REDACTED FOR PRIVACY Tech Fax: REDACTED FOR PRIVACY Tech Fax Ext: REDACTED FOR PRIVACY Tech Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name. Name Server: ns1.markmonitor.com Name Server: ns2.markmonitor.com Name Server: ns3.markmonitor.com Name Server: ns4.markmonitor.com Name Server: ns5.markmonitor.com Name Server: ns6.markmonitor.com Name Server: ns7.markmonitor.com DNSSEC: unsigned URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-12-18T15:16:03Z |
| Server IP | 3.33.139.32 |
| Server Location | United States of America |
| Service Provider | AMAZON-02 |
| Domains (TLD) | Status |
|---|---|
| oprahwinfreyleadershipacademy.com | Already Registered |
| oprahwinfreyleadershipacademy.net | Available |
| oprahwinfreyleadershipacademy.biz | Available |
| oprahwinfreyleadershipacademy.io | Already Registered |
| oprahwinfreyleadershipacademy.info | Already Registered |
| Domains (TLD) | Status |
|---|---|
| iprahwinfreyleadershipacademy.org | Already Registered |
| kprahwinfreyleadershipacademy.org | Already Registered |
| lprahwinfreyleadershipacademy.org | Already Registered |
| pprahwinfreyleadershipacademy.org | Already Registered |
| oorahwinfreyleadershipacademy.org | Already Registered |
| Silencebrise.com |
| Lartigue.ch |
| Tirsoperez.com |
| Matteodigiulio.com |
| Qingdaogarden.com |
| Idube.com |
| Euwyn.com |
| Getgov2go.com |
| Opensurface.io |
| Pidustore.com |